PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029915-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 157aa    MW: 17551.5 Da    PI: 4.8782
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029915-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB163.14e-5135129397
                  NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                            eq+r++Pianv+rimk++lP nak+sk+aket+qecvsefi+fvt+eas+kc++e+rkt+ngdd++wa+atlGf+dy+ pl+ yl++y
  SMil_00029915-RA_Salv  35 EQERLVPIANVGRIMKQILPPNAKVSKEAKETMQECVSEFIGFVTGEASEKCRKERRKTVNGDDVCWAMATLGFDDYAPPLRRYLERY 122
                            89************************************************************************************** PP

                  NF-YB  91 relegek 97 
                            rele ++
  SMil_00029915-RA_Salv 123 RELEVDR 129
                            ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.7E-4931151IPR009072Histone-fold
SuperFamilySSF471136.45E-3736149IPR009072Histone-fold
PfamPF008089.0E-2640103IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-166785No hitNo description
PRINTSPR006151.2E-1686104No hitNo description
PRINTSPR006151.2E-16105123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MSTSNNNNDN NNSFDSSKAV FSISMAESGS SLAGEQERLV PIANVGRIMK QILPPNAKVS  60
KEAKETMQEC VSEFIGFVTG EASEKCRKER RKTVNGDDVC WAMATLGFDD YAPPLRRYLE  120
RYRELEVDRV NQNKAGNSGE MDDNLLYTQN KPQRDSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4135124392Transcription factor HapC (Eurofung)
4g92_B2e-4135124392Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091059.14e-75PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822481e-56NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLB9RT321e-62B9RT32_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0008s22520.19e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-49nuclear factor Y, subunit B5